Ver mas grande
GOPC (Human) Recombinant Protein
AB-P3403
Producto nuevo
GOPC (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GOPC |
| Gene Alias | CAL|FIG|GOPC1|PIST|dJ94G16.2 |
| Gene Description | golgi associated PDZ and coiled-coil motif containing |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol). |
| Gene ID | 57120 |
Más información
Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.