Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
GOPC (Human) Recombinant Protein
Abnova
GOPC (Human) Recombinant Protein
Ref: AB-P3403
GOPC (Human) Recombinant Protein
Contacte-nos
Información del producto
Human GOPC (NP_001017408, 278 a.a. - 454 a.a.) partial recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
GOPC
Gene Alias
CAL|FIG|GOPC1|PIST|dJ94G16.2
Gene Description
golgi associated PDZ and coiled-coil motif containing
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Form
Liquid
Antigen species Target species
Human
Quality control testing
3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer
In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID
57120
Enviar uma mensagem
GOPC (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*