SLC35B2 (Human) Recombinant Protein (P01) Ver mas grande

SLC35B2 (Human) Recombinant Protein (P01)

AB-H00347734-P01

Producto nuevo

SLC35B2 (Human) Recombinant Protein (P01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name SLC35B2
Gene Alias PAPST1|SLL|UGTrel4
Gene Description solute carrier family 35, member B2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 347734

Más información

Human SLC35B2 full-length ORF ( NP_835361.1, 1 a.a. - 432 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

SLC35B2 (Human) Recombinant Protein (P01)

SLC35B2 (Human) Recombinant Protein (P01)