SLC35B2 (Human) Recombinant Protein (P01) View larger

Human SLC35B2 full-length ORF ( NP_835361.1, 1 a.a. - 432 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00347734-P01

New product

SLC35B2 (Human) Recombinant Protein (P01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 2 ug
Gene Name SLC35B2
Gene Alias PAPST1|SLL|UGTrel4
Gene Description solute carrier family 35, member B2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDARWWAVVVLAAFPSLGAGGETPEAPPESWTQLWFFRFVVNAAGYASFMVPGYLLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETTPMWQALKLLFCATGLQVSYLTWGVLQERVMTRSYGATATSPGERFTDSQFLVLMNRVLALIVAGLSCVLCKQPRHGAPMYRYSFASLSNVLSSWCQYEALKFVSFPTQVLAKASKVIPVMLMGKLVSRRSYEHWEYLTATLISIGVSMFLL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 347734

More info

Human SLC35B2 full-length ORF ( NP_835361.1, 1 a.a. - 432 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human SLC35B2 full-length ORF ( NP_835361.1, 1 a.a. - 432 a.a.) recombinant protein with GST-tag at N-terminal.

Human SLC35B2 full-length ORF ( NP_835361.1, 1 a.a. - 432 a.a.) recombinant protein with GST-tag at N-terminal.