ACE2 (Human) Recombinant Protein
  • ACE2 (Human) Recombinant Protein

ACE2 (Human) Recombinant Protein

Ref: AB-H00059272-H02
ACE2 (Human) Recombinant Protein

Información del producto

Purified ACE2 (NP_068576.1 , 18 a.a. - 740 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name ACE2
Gene Alias ACEH|DKFZp434A014
Gene Description angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration >= 10 ug/ml
Application Key WB,ELISA,SDS-PAGE
Immunogen Prot. Seq QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293F cells
Gene ID 59272

Enviar un mensaje


ACE2 (Human) Recombinant Protein

ACE2 (Human) Recombinant Protein