Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
ACE2 (Human) Recombinant Protein
Abnova
ACE2 (Human) Recombinant Protein
Ref: AB-H00059272-H02
ACE2 (Human) Recombinant Protein
Contacte-nos
Información del producto
Purified ACE2 (NP_068576.1 , 18 a.a. - 740 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size
25 ug
Gene Name
ACE2
Gene Alias
ACEH|DKFZp434A014
Gene Description
angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration
>= 10 ug/ml
Application Key
WB,ELISA,SDS-PAGE
Immunogen Prot. Seq
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG
Form
Liquid
Antigen species Target species
Human
Quality control testing
SDS-PAGE and Western Blot
Storage Buffer
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host
Human HEK293F cells
Gene ID
59272
Enviar uma mensagem
ACE2 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*