Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
WNT9A (Human) Recombinant Protein (P01)
Abnova
WNT9A (Human) Recombinant Protein (P01)
Ref: AB-H00007483-P01
WNT9A (Human) Recombinant Protein (P01)
Contáctenos
Información del producto
Human WNT9A full-length ORF ( NP_003386, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
WNT9A
Gene Alias
MGC138165|MGC141991|WNT14
Gene Description
wingless-type MMTV integration site family, member 9A
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGS
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
7483
Enviar un mensaje
WNT9A (Human) Recombinant Protein (P01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*