WNT9A (Human) Recombinant Protein (P01)
  • WNT9A (Human) Recombinant Protein (P01)

WNT9A (Human) Recombinant Protein (P01)

Ref: AB-H00007483-P01
WNT9A (Human) Recombinant Protein (P01)

Información del producto

Human WNT9A full-length ORF ( NP_003386, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name WNT9A
Gene Alias MGC138165|MGC141991|WNT14
Gene Description wingless-type MMTV integration site family, member 9A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MLDGSPLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7483

Enviar uma mensagem


WNT9A (Human) Recombinant Protein (P01)

WNT9A (Human) Recombinant Protein (P01)