Ver mas grande
TFRC (Human) Recombinant Protein
AB-H00007037-H02
Producto nuevo
TFRC (Human) Recombinant Protein
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | TFRC |
| Gene Alias | CD71|TFR|TFR1|TRFR |
| Gene Description | transferrin receptor (p90, CD71) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | CKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAE |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293H cells |
| Gene ID | 7037 |
Más información
Purified TFRC (ABM83785.1, 89 a.a. - 760 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.