TFRC (Human) Recombinant Protein
  • TFRC (Human) Recombinant Protein

TFRC (Human) Recombinant Protein

Ref: AB-H00007037-H02
TFRC (Human) Recombinant Protein

Información del producto

Purified TFRC (ABM83785.1, 89 a.a. - 760 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TFRC
Gene Alias CD71|TFR|TFR1|TRFR
Gene Description transferrin receptor (p90, CD71)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq CKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAE
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 7037

Enviar uma mensagem


TFRC (Human) Recombinant Protein

TFRC (Human) Recombinant Protein