Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
ATP6V0A1 (Human) Recombinant Protein (P01)
Abnova
ATP6V0A1 (Human) Recombinant Protein (P01)
Ref: AB-H00000535-P01
ATP6V0A1 (Human) Recombinant Protein (P01)
Contáctenos
Información del producto
Human ATP6V0A1 full-length ORF ( NP_005168.2, 1 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
ATP6V0A1
Gene Alias
ATP6N1|ATP6N1A|DKFZp781J1951|Stv1|VPP1|Vph1|a1
Gene Description
ATPase, H+ transporting, lysosomal V0 subunit a1
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERK
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
535
Enviar un mensaje
ATP6V0A1 (Human) Recombinant Protein (P01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*