ATP6V0A1 (Human) Recombinant Protein (P01)
  • ATP6V0A1 (Human) Recombinant Protein (P01)

ATP6V0A1 (Human) Recombinant Protein (P01)

Ref: AB-H00000535-P01
ATP6V0A1 (Human) Recombinant Protein (P01)

Información del producto

Human ATP6V0A1 full-length ORF ( NP_005168.2, 1 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name ATP6V0A1
Gene Alias ATP6N1|ATP6N1A|DKFZp781J1951|Stv1|VPP1|Vph1|a1
Gene Description ATPase, H+ transporting, lysosomal V0 subunit a1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGELFRSEEMTLAQLFLQSEAAYCCVSELGELGKVQFRDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPEVPFPRDMIDLEANFEKIENELKEINTNQEALKRNFLELTELKFILRKTQQFFDEMADPDLLEESSSLLEPSEMGRGTPLRLGFVAGVINRERIPTFERMLWRVCRGNVFLRQAEIENPLEDPVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 535

Enviar uma mensagem


ATP6V0A1 (Human) Recombinant Protein (P01)

ATP6V0A1 (Human) Recombinant Protein (P01)