Anti-AHDC1 Antibody 25ul Ver mas grande

Anti-AHDC1 Antibody 25ul

AN-HPA028691-25ul

Producto nuevo

Anti-AHDC1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name AHDC1
Gene Description AT hook, DNA binding motif, containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Immunogen SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Product Group Polyclonal Antibodies
Alternative Names DJ159A19.3, RP1-159A19.1
Host RABBIT
UniProt ID Q5TGY3
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human AHDC1, Gene description: AT hook, DNA binding motif, containing 1, Alternative Gene Names: DJ159A19.3, RP1-159A19.1, Validated applications: ICC, Uniprot ID: Q5TGY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image