Anti-AHDC1 Antibody 25ul View larger

Anti-AHDC1 Antibody 25ul

AN-HPA028691-25ul

New product

Anti-AHDC1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 25ul
Gene Name AHDC1
Gene Description AT hook, DNA binding motif, containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Immunogen SSLSSLEKLMMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRST
Product Group Polyclonal Antibodies
Alternative Names DJ159A19.3, RP1-159A19.1
Host RABBIT
UniProt ID Q5TGY3
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

More info

Polyclonal Antibody against Human AHDC1, Gene description: AT hook, DNA binding motif, containing 1, Alternative Gene Names: DJ159A19.3, RP1-159A19.1, Validated applications: ICC, Uniprot ID: Q5TGY3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image