GIP polyclonal antibody
  • GIP polyclonal antibody

GIP polyclonal antibody

Ref: AB-PAB4990
GIP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of GIP.
Información adicional
Size 150 ug
Gene Name GIP
Gene Alias -
Gene Description gastric inhibitory polypeptide
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GIP.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 2695

Enviar un mensaje


GIP polyclonal antibody

GIP polyclonal antibody