Ver mas grande
GIP polyclonal antibody
AB-PAB4990
Producto nuevo
GIP polyclonal antibody
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 150 ug |
| Gene Name | GIP |
| Gene Alias | - |
| Gene Description | gastric inhibitory polypeptide |
| Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,EIA |
| Immunogen Prot. Seq | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Form | Liquid |
| Recomended Dilution | The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against synthetic peptide. |
| Immunogen | A synthetic peptide (conjugated with KLH) corresponding to human GIP. |
| Storage Buffer | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
| Gene ID | 2695 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of GIP.