AB-PAB4990
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 150 ug |
Gene Name | GIP |
Gene Alias | - |
Gene Description | gastric inhibitory polypeptide |
Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IP,EIA |
Immunogen Prot. Seq | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Form | Liquid |
Recomended Dilution | The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against synthetic peptide. |
Immunogen | A synthetic peptide (conjugated with KLH) corresponding to human GIP. |
Storage Buffer | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
Gene ID | 2695 |