AB-PAB4990
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 150 ug |
Gene Name | GIP |
Gene Alias | - |
Gene Description | gastric inhibitory polypeptide |
Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IP,EIA |
Immunogen Prot. Seq | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
Form | Liquid |
Recomended Dilution | The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against synthetic peptide. |
Immunogen | A synthetic peptide (conjugated with KLH) corresponding to human GIP. |
Storage Buffer | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
Gene ID | 2695 |