Ver mas grande
MRPL39 polyclonal antibody
AB-PAB31602
Producto nuevo
MRPL39 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | MRPL39 |
| Gene Alias | C21orf92|FLJ20451|L39mt|MGC104174|MGC3400|MRP-L5|MRPL5|MSTP003|PRED22|PRED66|RPML5 |
| Gene Description | mitochondrial ribosomal protein L39 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)<br>Western Blot (1:100-250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human MRPL39. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 54148 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against partial recombinant human MRPL39.