MRPL39 polyclonal antibody
  • MRPL39 polyclonal antibody

MRPL39 polyclonal antibody

Ref: AB-PAB31602
MRPL39 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MRPL39.
Información adicional
Size 100 uL
Gene Name MRPL39
Gene Alias C21orf92|FLJ20451|L39mt|MGC104174|MGC3400|MRP-L5|MRPL5|MSTP003|PRED22|PRED66|RPML5
Gene Description mitochondrial ribosomal protein L39
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPSLIRRFQGVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKAT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-50)
Western Blot (1:100-250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MRPL39.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 54148
Iso type IgG

Enviar uma mensagem


MRPL39 polyclonal antibody

MRPL39 polyclonal antibody