CIB4 polyclonal antibody Ver mas grande

CIB4 polyclonal antibody

AB-PAB31576

Producto nuevo

CIB4 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name CIB4
Gene Alias KIP4
Gene Description calcium and integrin binding family member 4
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CIB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 130106
Iso type IgG

Más información

Rabbit polyclonal antibody raised against partial recombinant human CIB4.

Consulta sobre un producto

CIB4 polyclonal antibody

CIB4 polyclonal antibody