AB-PAB31576
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Size | 100 uL |
Gene Name | CIB4 |
Gene Alias | KIP4 |
Gene Description | calcium and integrin binding family member 4 |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | IHC-P |
Immunogen Prot. Seq | ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | Recombinant protein corresponding to human CIB4. |
Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Gene ID | 130106 |
Iso type | IgG |