CIB4 polyclonal antibody
  • CIB4 polyclonal antibody

CIB4 polyclonal antibody

Ref: AB-PAB31576
CIB4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CIB4.
Información adicional
Size 100 uL
Gene Name CIB4
Gene Alias KIP4
Gene Description calcium and integrin binding family member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CIB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 130106
Iso type IgG

Enviar uma mensagem


CIB4 polyclonal antibody

CIB4 polyclonal antibody