SAG polyclonal antibody
  • SAG polyclonal antibody

SAG polyclonal antibody

Ref: AB-PAB31071
SAG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SAG.
Información adicional
Size 100 uL
Gene Name SAG
Gene Alias DKFZp686D1084|DKFZp686I1383|S-AG
Gene Description S-antigen
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SAG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6295
Iso type IgG

Enviar un mensaje


SAG polyclonal antibody

SAG polyclonal antibody