View larger
Rabbit polyclonal antibody raised against partial recombinant human SAG.
AB-PAB31071
New product
SAG polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | SAG |
| Gene Alias | DKFZp686D1084|DKFZp686I1383|S-AG |
| Gene Description | S-antigen |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P |
| Immunogen Prot. Seq | EPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKS |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:2500-5000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human SAG. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 6295 |
| Iso type | IgG |
More info
Rabbit polyclonal antibody raised against partial recombinant human SAG.