AB-PAB30011
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 100 uL |
Gene Name | CRELD1 |
Gene Alias | AVSD2|CIRRIN|DKFZp566D213 |
Gene Description | cysteine-rich with EGF-like domains 1 |
Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,IHC-P |
Immunogen Prot. Seq | TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (5 ug/mL)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | A synthetic peptide corresponding to C-terminus of human CRELD1. |
Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
Gene ID | 78987 |