CRELD1 polyclonal antibody
  • CRELD1 polyclonal antibody

CRELD1 polyclonal antibody

Ref: AB-PAB30011
CRELD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CRELD1.
Información adicional
Size 100 uL
Gene Name CRELD1
Gene Alias AVSD2|CIRRIN|DKFZp566D213
Gene Description cysteine-rich with EGF-like domains 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human CRELD1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 78987

Enviar uma mensagem


CRELD1 polyclonal antibody

CRELD1 polyclonal antibody