Ver mas grande
KLHL31 polyclonal antibody
AB-PAB29897
Producto nuevo
KLHL31 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | KLHL31 |
| Gene Alias | BKLHD6|KBTBD1|KLHL|bA345L23.2 |
| Gene Description | kelch-like 31 (Drosophila) |
| Storage Conditions | Store at 4ºC for up to one week. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:250)<br>Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to amino acids 501-550 of human KLHL31. |
| Storage Buffer | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Gene ID | 401265 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against partial synthetic protein of human KLHL31.