KLHL31 polyclonal antibody
  • KLHL31 polyclonal antibody

KLHL31 polyclonal antibody

Ref: AB-PAB29897
KLHL31 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KLHL31.
Información adicional
Size 100 uL
Gene Name KLHL31
Gene Alias BKLHD6|KBTBD1|KLHL|bA345L23.2
Gene Description kelch-like 31 (Drosophila)
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 501-550 of human KLHL31.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 401265
Iso type IgG

Enviar uma mensagem


KLHL31 polyclonal antibody

KLHL31 polyclonal antibody