Ver mas grande
SLC2A5 polyclonal antibody
AB-PAB29883
Producto nuevo
SLC2A5 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | SLC2A5 |
| Gene Alias | GLUT5 |
| Gene Description | solute carrier family 2 (facilitated glucose/fructose transporter), member 5 |
| Storage Conditions | Store at 4ºC for up to 1 week. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IF |
| Immunogen Prot. Seq | ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1:100)<br>Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to amino acids 300-349 of human SLC2A5. |
| Storage Buffer | In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide). |
| Gene ID | 6518 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against partial synthetic protein of human SLC2A5.