SLC2A5 polyclonal antibody
  • SLC2A5 polyclonal antibody

SLC2A5 polyclonal antibody

Ref: AB-PAB29883
SLC2A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human SLC2A5.
Información adicional
Size 100 uL
Gene Name SLC2A5
Gene Alias GLUT5
Gene Description solute carrier family 2 (facilitated glucose/fructose transporter), member 5
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Form Liquid
Recomended Dilution Immunofluorescence (1:100)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 300-349 of human SLC2A5.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 6518
Iso type IgG

Enviar uma mensagem


SLC2A5 polyclonal antibody

SLC2A5 polyclonal antibody