Ver mas grande
DDX3X polyclonal antibody
AB-PAB29522
Producto nuevo
DDX3X polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | DDX3X |
| Gene Alias | DBX|DDX14|DDX3|HLP2 |
| Gene Description | DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:500-1:1000)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to human DDX3X. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 1654 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant human DDX3X.