DDX3X polyclonal antibody
  • DDX3X polyclonal antibody

DDX3X polyclonal antibody

Ref: AB-PAB29522
DDX3X polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DDX3X.
Información adicional
Size 100 uL
Gene Name DDX3X
Gene Alias DBX|DDX14|DDX3|HLP2
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DDX3X.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1654
Iso type IgG

Enviar un mensaje


DDX3X polyclonal antibody

DDX3X polyclonal antibody