DDX3X polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant human DDX3X.

AB-PAB29522

New product

DDX3X polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name DDX3X
Gene Alias DBX|DDX14|DDX3|HLP2
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DDX3X.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1654
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant human DDX3X.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant human DDX3X.

Rabbit polyclonal antibody raised against recombinant human DDX3X.