Ver mas grande
ENG polyclonal antibody
AB-PAB29312
Producto nuevo
ENG polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | ENG |
| Gene Alias | CD105|END|FLJ41744|HHT1|ORW|ORW1 |
| Gene Description | endoglin |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P,IF |
| Immunogen Prot. Seq | ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (1:200-1:500)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids 312-438 of human ENG. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 2022 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant human ENG.