ENG polyclonal antibody
  • ENG polyclonal antibody

ENG polyclonal antibody

Ref: AB-PAB29312
ENG polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ENG.
Información adicional
Size 100 uL
Gene Name ENG
Gene Alias CD105|END|FLJ41744|HHT1|ORW|ORW1
Gene Description endoglin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 312-438 of human ENG.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2022
Iso type IgG

Enviar uma mensagem


ENG polyclonal antibody

ENG polyclonal antibody