Ver mas grande
BTK polyclonal antibody
AB-PAB29308
Producto nuevo
BTK polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | BTK |
| Gene Alias | AGMX1|AT|ATK|BPK|IMD1|MGC126261|MGC126262|PSCTK1|XLA |
| Gene Description | Bruton agammaglobulinemia tyrosine kinase |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P,IF |
| Immunogen Prot. Seq | PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL |
| Form | Liquid |
| Recomended Dilution | Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (1:200-1:500)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids 206-351 of human BTK. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 695 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant human BTK.