BTK polyclonal antibody
  • BTK polyclonal antibody

BTK polyclonal antibody

Ref: AB-PAB29308
BTK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BTK.
Información adicional
Size 100 uL
Gene Name BTK
Gene Alias AGMX1|AT|ATK|BPK|IMD1|MGC126261|MGC126262|PSCTK1|XLA
Gene Description Bruton agammaglobulinemia tyrosine kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 206-351 of human BTK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 695
Iso type IgG

Enviar uma mensagem


BTK polyclonal antibody

BTK polyclonal antibody