Ver mas grande
RNASEL polyclonal antibody
AB-PAB28675
Producto nuevo
RNASEL polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | RNASEL |
| Gene Alias | DKFZp781D08126|MGC104972|MGC133329|PRCA1|RNS4 |
| Gene Description | ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC |
| Immunogen Prot. Seq | HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry <br> Western Blot <br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human RNASEL. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 6041 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant RNASEL.