RNASEL polyclonal antibody
  • RNASEL polyclonal antibody

RNASEL polyclonal antibody

Ref: AB-PAB28675
RNASEL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RNASEL.
Información adicional
Size 100 uL
Gene Name RNASEL
Gene Alias DKFZp781D08126|MGC104972|MGC133329|PRCA1|RNS4
Gene Description ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI
Form Liquid
Recomended Dilution Immunohistochemistry
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RNASEL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6041
Iso type IgG

Enviar uma mensagem


RNASEL polyclonal antibody

RNASEL polyclonal antibody