Ver mas grande
PPFIBP2 polyclonal antibody
AB-PAB28658
Producto nuevo
PPFIBP2 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | PPFIBP2 |
| Gene Alias | Cclp1|DKFZp781K06126|MGC42541 |
| Gene Description | PTPRF interacting protein, binding protein 2 (liprin beta 2) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P,IF |
| Immunogen Prot. Seq | SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL |
| Form | liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)<br>Immunofluorescence (1-4 ug/ml)<br>Western Blot (1:100-1:250)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human PPFIBP2. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 8495 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant PPFIBP2.