PPFIBP2 polyclonal antibody
  • PPFIBP2 polyclonal antibody

PPFIBP2 polyclonal antibody

Ref: AB-PAB28658
PPFIBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPFIBP2.
Información adicional
Size 100 uL
Gene Name PPFIBP2
Gene Alias Cclp1|DKFZp781K06126|MGC42541
Gene Description PTPRF interacting protein, binding protein 2 (liprin beta 2)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPFIBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8495
Iso type IgG

Enviar uma mensagem


PPFIBP2 polyclonal antibody

PPFIBP2 polyclonal antibody