ZNF235 polyclonal antibody
  • ZNF235 polyclonal antibody

ZNF235 polyclonal antibody

Ref: AB-PAB24428
ZNF235 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF235.
Información adicional
Size 100 uL
Gene Name ZNF235
Gene Alias ANF270|HZF6|ZFP93|ZNF270
Gene Description zinc finger protein 235
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF235.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9310
Iso type IgG

Enviar un mensaje


ZNF235 polyclonal antibody

ZNF235 polyclonal antibody