Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZNF235 polyclonal antibody
Abnova
ZNF235 polyclonal antibody
Ref: AB-PAB24428
ZNF235 polyclonal antibody
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against recombinant ZNF235.
Información adicional
Size
100 uL
Gene Name
ZNF235
Gene Alias
ANF270|HZF6|ZFP93|ZNF270
Gene Description
zinc finger protein 235
Storage Conditions
Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
WB,IHC-P
Immunogen Prot. Seq
ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH
Form
Liquid
Recomended Dilution
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species
Human
Immunogen
Recombinant protein corresponding to amino acids of human ZNF235.
Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID
9310
Iso type
IgG
Enviar uma mensagem
ZNF235 polyclonal antibody
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*