Ver mas grande
TIMM23 polyclonal antibody
AB-PAB22549
Producto nuevo
TIMM23 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | TIMM23 |
| Gene Alias | FLJ40725|FLJ56773|FLJ57459|FLJ79448|MGC71995|MGC87383|TIM23 |
| Gene Description | translocase of inner mitochondrial membrane 23 homolog (yeast) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IHC-P,IF |
| Immunogen Prot. Seq | TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:10-1:20)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human TIMM23. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 100287932 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant TIMM23.