TIMM23 polyclonal antibody
  • TIMM23 polyclonal antibody

TIMM23 polyclonal antibody

Ref: AB-PAB22549
TIMM23 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIMM23.
Información adicional
Size 100 uL
Gene Name TIMM23
Gene Alias FLJ40725|FLJ56773|FLJ57459|FLJ79448|MGC71995|MGC87383|TIM23
Gene Description translocase of inner mitochondrial membrane 23 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIMM23.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 100287932
Iso type IgG

Enviar uma mensagem


TIMM23 polyclonal antibody

TIMM23 polyclonal antibody