RPH3AL polyclonal antibody Ver mas grande

RPH3AL polyclonal antibody

AB-PAB21678

Producto nuevo

RPH3AL polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name RPH3AL
Gene Alias NOC2
Gene Description rabphilin 3A-like (without C2 domains)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPH3AL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9501
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant RPH3AL.

Consulta sobre un producto

RPH3AL polyclonal antibody

RPH3AL polyclonal antibody