RPH3AL polyclonal antibody
  • RPH3AL polyclonal antibody

RPH3AL polyclonal antibody

Ref: AB-PAB21678
RPH3AL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPH3AL.
Información adicional
Size 100 uL
Gene Name RPH3AL
Gene Alias NOC2
Gene Description rabphilin 3A-like (without C2 domains)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPH3AL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9501
Iso type IgG

Enviar uma mensagem


RPH3AL polyclonal antibody

RPH3AL polyclonal antibody