MYO10 polyclonal antibody
  • MYO10 polyclonal antibody

MYO10 polyclonal antibody

Ref: AB-PAB21665
MYO10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MYO10.
Información adicional
Size 100 uL
Gene Name MYO10
Gene Alias FLJ10639|FLJ21066|FLJ22268|FLJ43256|KIAA0799|MGC131988
Gene Description myosin X
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)
Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4651
Iso type IgG

Enviar un mensaje


MYO10 polyclonal antibody

MYO10 polyclonal antibody