MYO10 polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant MYO10.

AB-PAB21665

New product

MYO10 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name MYO10
Gene Alias FLJ10639|FLJ21066|FLJ22268|FLJ43256|KIAA0799|MGC131988
Gene Description myosin X
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRNIERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSA
Form Liquid
Recomended Dilution Immunofluorescence (0.25-2 ug/mL)<br>Immunohistochemistry (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MYO10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4651
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant MYO10.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant MYO10.

Rabbit polyclonal antibody raised against recombinant MYO10.