TBC1D8B polyclonal antibody Ver mas grande

TBC1D8B polyclonal antibody

AB-PAB21616

Producto nuevo

TBC1D8B polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name TBC1D8B
Gene Alias FLJ20298
Gene Description TBC1 domain family, member 8B (with GRAM domain)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSAKGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQWSFAFEQILA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54885
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant TBC1D8B.

Consulta sobre un producto

TBC1D8B polyclonal antibody

TBC1D8B polyclonal antibody