TBC1D8B polyclonal antibody
  • TBC1D8B polyclonal antibody

TBC1D8B polyclonal antibody

Ref: AB-PAB21616
TBC1D8B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TBC1D8B.
Información adicional
Size 100 uL
Gene Name TBC1D8B
Gene Alias FLJ20298
Gene Description TBC1 domain family, member 8B (with GRAM domain)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSAKGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQWSFAFEQILA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54885
Iso type IgG

Enviar uma mensagem


TBC1D8B polyclonal antibody

TBC1D8B polyclonal antibody