TBC1D8B polyclonal antibody View larger

Rabbit polyclonal antibody raised against recombinant TBC1D8B.

AB-PAB21616

New product

TBC1D8B polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name TBC1D8B
Gene Alias FLJ20298
Gene Description TBC1 domain family, member 8B (with GRAM domain)
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHVSKPANEKEAESAKHSPEKGKGKIDIQAYLSQWQDELFKKEENIKDLPRMNQSQFIQFSKTLYNLFHEDPEEESLYQAIAVVTSLLLRMEEVGRKLHSPTSSAKGFSGTVCGSGGPSEEKTGSHLEKDPCSFREEPQWSFAFEQILA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TBC1D8B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54885
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant TBC1D8B.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant TBC1D8B.

Rabbit polyclonal antibody raised against recombinant TBC1D8B.