Ver mas grande
CCDC43 polyclonal antibody
AB-PAB21566
Producto nuevo
CCDC43 polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | CCDC43 |
| Gene Alias | FLJ31795 |
| Gene Description | coiled-coil domain containing 43 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB,IHC-P |
| Immunogen Prot. Seq | SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:500-1:1000)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human CCDC43. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene ID | 124808 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant CCDC43.