CCDC43 polyclonal antibody
  • CCDC43 polyclonal antibody

CCDC43 polyclonal antibody

Ref: AB-PAB21566
CCDC43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC43.
Información adicional
Size 100 uL
Gene Name CCDC43
Gene Alias FLJ31795
Gene Description coiled-coil domain containing 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SGATTMNIGSDKLLFRNTNVEDVLNARKLERDSLRDESQRKKEQDKLQRERDKLAKQERKE
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124808
Iso type IgG

Enviar uma mensagem


CCDC43 polyclonal antibody

CCDC43 polyclonal antibody